Protein Localization

Everything on bioinformatics, the science of information technology as applied to biological research.

Moderators: honeev, Leonid, amiradm, BioTeam

Post Reply
rosegarden
Garter
Garter
Posts: 6
Joined: Mon Feb 21, 2011 6:05 am

Protein Localization

Post by rosegarden » Tue Feb 22, 2011 1:54 am

Hey guys, so I'm given a long strand of protein (shown below). It is predicted to be nuclear localized but how can I know that it's nuclear localized just by looking at its primary sequence? I mean we can probably do some protein tagging to localize it experimentally but I have no idea how the prediction part comes about. Thanks in advance for any help.

mdkvlnreeslqlmdllglersawgniplmrkaylkkckefhpdkggdeekmkkmntlyk
kmedgvkyahqpdfggfwdateiptygtdeweqwwnafneenlfcseempssddeatads
qhstppkkkrkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekys
vtfisrhnsynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdp
fsvieeslpgglkehdfnpeeaeetkqvswklvteyametkcddvllllgmylefqysfe
mclkcikkeqpshykyhekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqm
ltnrfndlldrmdimfgstgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkr
ywlfkgpidsgkttlaaallelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtgg
esrdlpsgqginnldnlrdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqar
fvkqidfrpkdylkhclersefllekriiqsgialllmliwyrpvaefaqsiqsrivewk
erldkefslsvyqkmkfnvamgigvldwlrnsddddedsqenadknedggeknmedsghe
tgidsqsqgsfqapqssqsvhdhnqpyhicrgftcfkkpptpppepet

User avatar
canalon
Inland Taipan
Inland Taipan
Posts: 3909
Joined: Thu Feb 03, 2005 2:46 pm
Location: Canada

Post by canalon » Tue Feb 22, 2011 3:13 am

Patrick

Science has proof without any certainty. Creationists have certainty without
any proof. (Ashley Montague)

rosegarden
Garter
Garter
Posts: 6
Joined: Mon Feb 21, 2011 6:05 am

Post by rosegarden » Tue Feb 22, 2011 3:52 am

I have used predictor tools but I want to know how to predict localization just by looking at the primary sequence.

User avatar
JackBean
Inland Taipan
Inland Taipan
Posts: 5694
Joined: Mon Sep 14, 2009 7:12 pm

Post by JackBean » Tue Feb 22, 2011 6:35 pm

but that's what the predictors do, they look on the primary structure and look for specific patterns, which could mean localisation into any organelle
http://www.biolib.cz/en/main/

Cis or trans? That's what matters.

rosegarden
Garter
Garter
Posts: 6
Joined: Mon Feb 21, 2011 6:05 am

Re: Protein Localization

Post by rosegarden » Wed Feb 23, 2011 12:14 am

does this have something to do with locating a part of the main sequence called the nuclear localization signal with indicates nuclear localization? and if so what is the sequence of the nuclear localization signal?

User avatar
JackBean
Inland Taipan
Inland Taipan
Posts: 5694
Joined: Mon Sep 14, 2009 7:12 pm

Post by JackBean » Wed Feb 23, 2011 9:13 am

http://www.biolib.cz/en/main/

Cis or trans? That's what matters.

Post Reply

Who is online

Users browsing this forum: No registered users and 0 guests