
|
|
Dictionary » W » Wheat Wheatwheat (Science: botany) A cereal grass (triticum vulgare) and its grain, which furnishes a white flour for bread, and, next to rice, is the grain most largely used by the human race. Of this grain the varieties are numerous, as red wheat, white wheat, bald wheat, bearded wheat, winter wheat, summer wheat, and the like. Wheat is not known to exist as a wild native plant, and all statements as to its origin are either incorrect or at best only guesses. Buck wheat. (Science: botany) The grain weevil. The rice weevil when found in wheat. Origin: OE. Whete, AS. Hwte; akin to OS. Hwti, D. Weit, G. Weizen, OHG. Weizzi, Icel. Hveiti, Sw. Hvete, Dan. Hvede, Goth. Hwaiteis, and E. While. See White. ![]()
Please contribute to this project, if you have more information about this term feel free to edit this page ![]()
Results from our forumStomach bloating and weight gainHay read a book called 'Wheat Belly' by William Davis. http://www.youtube.com/watch?v=47QlothkpsE
See entire post
Re: Stomach bloating and weight gain... & Lactose intolerance, Egg Allergy & Coeliac's Disease. Therefore my bloating cannot be a reaction due to sugar intake or for that matter wheat intake. I am constinatly on laxatives, as without them I would become severly constipated (this is due to my intolerances and allergies) In 2010 ...
See entire post
Re:... spatial expression should be enough to say) Not in plants. Here is an alignment of a couple of genes to help visualize the problem: BWB16106 VRN1 Wheat BWB16185 VRN1 Arabidopsis BWB16185 MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIW BWB16106 MGRGKVQLKRIENKIN-RQVTFSKRRSGLLKKAHEISVLCDAEVG--------------- ...
See entire post
Diet Of Laying Birds@ animato, yes, by wheat offal, I mean bran. This my question was set at a time when mad cow disease have not being discovered. When it was found that mad cow disease is transmitted to cattle as a result of taking diet made of bonemeal; ...
See entire post
Re: Stomach bloating and weight gain... Need to take HIGH quality PROBOTICS (the type that are kept in the refrigerator) - take 2 or 3 times the regular dose, stay away from ALL WHEAT, RYE, BARLEY, YEAST, FERMENTED FOODS, VINEGAR...... eat Yogurt with Probiotics and vegatables and HIGH PROTEIN FOODS. If you have your blood tested ...
See entire post
This page was last modified 21:16, 3 October 2005. This page has been accessed 3,700 times. |
© Biology-Online.org. All Rights Reserved.
Register | Login
| About Us | Contact Us | Link to Us | Disclaimer & Privacy