Login

|
|
Protein LocalizationModerator: BioTeam
6 posts • Page 1 of 1
Protein LocalizationHey guys, so I'm given a long strand of protein (shown below). It is predicted to be nuclear localized but how can I know that it's nuclear localized just by looking at its primary sequence? I mean we can probably do some protein tagging to localize it experimentally but I have no idea how the prediction part comes about. Thanks in advance for any help.
mdkvlnreeslqlmdllglersawgniplmrkaylkkckefhpdkggdeekmkkmntlyk kmedgvkyahqpdfggfwdateiptygtdeweqwwnafneenlfcseempssddeatads qhstppkkkrkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekys vtfisrhnsynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdp fsvieeslpgglkehdfnpeeaeetkqvswklvteyametkcddvllllgmylefqysfe mclkcikkeqpshykyhekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqm ltnrfndlldrmdimfgstgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkr ywlfkgpidsgkttlaaallelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtgg esrdlpsgqginnldnlrdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqar fvkqidfrpkdylkhclersefllekriiqsgialllmliwyrpvaefaqsiqsrivewk erldkefslsvyqkmkfnvamgigvldwlrnsddddedsqenadknedggeknmedsghe tgidsqsqgsfqapqssqsvhdhnqpyhicrgftcfkkpptpppepet
Patrick
Science has proof without any certainty. Creationists have certainty without any proof. (Ashley Montague)
I have used predictor tools but I want to know how to predict localization just by looking at the primary sequence.
Re: Protein Localizationdoes this have something to do with locating a part of the main sequence called the nuclear localization signal with indicates nuclear localization? and if so what is the sequence of the nuclear localization signal?
6 posts • Page 1 of 1
Who is onlineUsers browsing this forum: No registered users and 0 guests |
© Biology-Online.org. All Rights Reserved. Register | Login | About Us | Contact Us | Link to Us | Disclaimer & Privacy