Login

Join for Free!
118868 members
table of contents table of contents

Biology Articles » Bioinformatics » Introductory Workbook on Perl for Biology Students » Appendix

Appendix
- Introductory Workbook on Perl for Biology Students

i. krupa.seq

 

TACTGTGGCCGTGCGTGGCTGCCGTTGCGCTGC

TCCTCGGGTCGATGCGATAGCTAGCTAGATCT

 

ii.Beta-globin gene:

 

TCGAGCTCTACACAGGTGACACACTAGAACCAGAGCGTGCGATCCTTCGGGAGCAGAGCCCAGAGTTCCT

CCGTGCCGACACGCAGCCCTCCTGCCGACACCATGGTGCAGTGGACAGCTGAGGAGAAGCAGCTCATCAC

CGGCCTCTGGGGCAAGGTCAACGTGGCCGAGTGCGGCGGCGAGGCCCTGGCCAGGCTGCTGATCGTCTAC

CCCTGGACCCAGAGGTTCTTCGCCTCCTTTGGGAACCTGTCCAGCCCCACCGCCGTCCTGGGCAACCCCA

AGGTGCAGGCCCATGGCAAGAAGGTGCTCACCTCCTTCGGGGAAGCCGTCAAGAACCTGGACAGCATCAA

GAACACCTTTTCCCAGCTGTCCGAGCTGCACTGTGACAAGCTGCACGTGGACCCTGAGAACTTCAGGCTC

CTGGGTGACATCCTGGTCGTTGTCCTGGCCGCCCACTTCGGCAAGGACTTCACTCCCGACTGCCAGGCCG

CCTGGCAGAAGCTGGTGCGCGTGGTTGCCCACGCCCTGGCCCGCAAGTACCACTGAGGAGCCGCAGGAGC

GCCCGGCAGCGCCCGCACCCGCTGCCGTCCGAGCCCACCGCTTCTAACAGCAAATAAAGCTCATCCTGTG

AAGCCTAAAAAAAAAAAAAAAAACACTCTTGGATC

 

iii. Prot.prot

 

MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV

TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH

LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA

LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS

GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGRGFGG

GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS

SSSSSYGSGRRF

 

iv. IL2:

 

 

Genomic sequence in Fasta format

 

>ref|NT_016354.18|Hs4_16510:47920772-47925797 Homo sapiens chromosome 4 genomic contig, reference assembly

 

TTTATATTTATCAAATTTATTAAATAGTTTTACTAACCAATCTACATAGATACTATATTTAACATTCAAC

ATAATAATAAATATTTTGGGATAAATAAGTGAAACCATTTTAGAGCCCCTAGGGCTTACAAAAAGAATCA

TAAAAGATCCATATTTATAGTTTTAAGATTAAGAATAATAGTTACAATAGGTAGCAAACCATACATTCAA

CAATAAATATAAAATTTAAATATTTAAATAAATAGAAGGCCTGATATGTTTTAAGTGGGAAGCACTTAAT

TATCAAGTCAGTGTTGAGATGATGCTTTGACAAAAGGTAATCCATCTGTTCAGAAATTCTACAATGGTTG

CTGTCTCATCAGCATATTCACACATGAATGTTGTTTCAGATCCCTATAAAAGAAAAATGTTAATTTTTTA

AAGTACAGAGTAGTTTACCTTATATACAGTTATTCCCAATTGAAGTCTTATAGGCCTGTTGCCTTTATTT

TCAAGCTTACCAAACATATTAATTATTCACATTTTCTTGAAATGATCAAAATGAATGCCAAAATTACATA

TTTTGTTATGATACCAAATGATAGTAACACAGAAGCTGAGATTTTCCTCATTTGTTAATTCAGTCAATGA

ACACAAAAATTTTTTCCCTAAATTGGGTGCAAATAAAGATTTAAATAAAAATAGATCTAGACAAATATTA

AATGCTGGATGTGAAATAAACTTGATCGCTTTTCCTCTGAATGTACACCTATATTTGTGTAAGTTAAATG

TATGAATTGATATGCACATTATACTTTCTTCTTTTCTAAATCTTGATTAGAGTCTCCTATTTTTCTACTT

AAGTGAATCTCCTTATATTTTCCCCAAAGCAGAACAGAACTACACTAGAGTAAGCTAGGACATGCTTCTG

TTTGGGATAAATTTGTGTGAAGAACATCTTCATAAATACTTACACCTATCCCTACCCCATCATAGTATCA

ATGCAGGTGAATTTGCCAACTTTTAAAAGTTTAAACATTAGAAATTTTGTTCTGTGGACTGGCTTTTTAG

AAATTAGGCTTCTCTGCTGAAAGGAGCTATTTAAACGCTTCCTCTAGTTGATAAGCTAAGGAGGAAATAT

TTTGATATATAGTGAGATTTAAAAGAGAGCTTTTCAAATTTGAAGTGATTCCTACCCTGGGAACAAAAGC

AGGTGAGATAGAGTGTTCCCTTTAAATAAGTATTCTCTTTTAAAAAACTGTTGCAGTGTTCTGTATCCTC

TTAAGCATAATTGTTTAAATATTGTCATATCTTGGGATTTTTTTATTTTAAAAAGTGTTTGGCTTTTGAA

ACACAGTTTTCAGATTTTTGCATGGTTTTGTCTTAAATTTGTATCAAGAGTTAAGAATGAGTTTTCTGAT

GTTAATTATTTTAGAGTAAAACTCTTGCCATAGATAAGGAACTGAATCTGTCAATGTCTAGATGACATTG

ATCTCAATGTATTTTTTTAATTCAACTGAAACAGTCCACTAATAAGTGATTCATTTGGACACAACTGGAG

TTACTTTTAGGAATGTCTTTTACTACTATACTTATGCTGCTTATTTAGGATACCTATTAACTCATGAATT

TTATACCTTAGGAGACGGGATATAAAAAGACAAAAGTGAATCTCTTTTACATCACCTGAGTCCCTTGCAT

ATTTTATGCTTCCTGTGCATTTAAAAATACTTAAGATTCTGAAAGTGGGGATTGCCTCTAAAAAGATTGT

TGTTTGTTTAGTCCACTGGCCATTTTAATGGCTCCAGTTTTTTTTTTTAAGACAAATCTCTTATGGGTAG

TCCTTCCATCAAATGATAAGGAAACACCATTTGAAAAGCCTTTCAGGTAATCAGTATTGGCTATTCCAGT

AAATGATCTGAAGGAATTGAAAAATATATAGTAAAATCTGCCTGCTTTCTGTGAAACTCAACTCAGTACC

TTCTCTCACTCCCAGTTTTGTGTTAATATGAAAGGTGATGGAGTTTGGGATGAGGCTTGTCCATTAGTAG

ATGGTAGGTGCAAACTCAGTAGCTTATACTCCCCAGTTAATCATTTAACATTAGAAATGATTCATGTTCA

CAGTGTACTTAAAATGTAGGCTAATTACATGCATGGGTACTTTACAAATACCAAAAATGTTATGTCACTT

TAAAATGTGGTACTTTTCCCCCTACTTTTTTTTTTTTATTTCCAGGAGAGCAAATAAAGTAATGCCTTAC

CTTTAGTTCCAGAACTATTACGTTGATATTGCTGATTAAGTCCCTGGGTCTTAAGTGAAAGTTTTTGCTT

TGAGCTAAATTTAGCACTTCCTCCAGAGGTTTGAGTTCTTCTTCTAGACACTGAAGATGTTTCAGTTCTG

TGGCCTAGAATAATAATTATCATCAGCTCAGTTTACATAGAGGTCAGAATCAGAAATTAATTTCCAATTT

ATTTTATTTGGAGTAGCAGTATGTAGTTTTTACCATTCTCTCTGTTCTCAATGTCACTGTAAAGATGGAC

CAGTAGAGTTTACATTATAAAACTGGAAAAACTAGGGCTCAAGTACCTATGACTAGCGTTAAGTGATAGT

TGACTCACTGGTTTTAGCTTAATTTGGCTTTGCAAAATGTTAGACTTTCTGCATCTAAATGCCTATTACA

GATGTAGGCTGATTACTTTTCCAATCTGCATAGAAAATCATTAGAACCAGATGAGTTAGAATGTGGAAGC

ATAAAAATCACATTCTATGATTATAATATTTGATAGTCTAAGAGTTAAGAATCACAGAATGTTGAGAGAG

AAGGAACTCTTGGATGCCATCTATCACAATCCCAACATTTTACACTAGGTAACAATAATCATGTAGTAGT

GGCTCTCAATATAGCCTTGAGCAAGACACATTTTTAAATATGTCTTAAATTTTTACTTTTCTACAATCAC

TACATTAAGATGCATTTTAAAAATGTTTGTCCCAGTGAAATAAAAAATTATAATACTTTGGGAGGACTTT

TGGACAGGCCTCTTGATTCTATATTATATATAATATTTCATATTTCTATGGTATATTACAATTTAAAAGA

ATTTTCTCCAAAATAGGCCCATTTACTTCTCACAGTCATCTTTTGAAGTAGGCAGTGAAGTATCATCTCC

ACTTTATAAATAAGCACACTAAATCTCAGAATTTGACCACATAAGTAGGTAGAGCCAGAATTAGATTTCA

TTTCTTTCTCATTATAGCATTAACATAGCATCCTTGGAATCAAATATTTTTATTAGTTTCTAAAATCTTT

TGTAAATGTGCAATGAGGGTTAAATGAACAAATGAATAGAGTTTATCATTACTTTTGGTTTCAAACTTAG

ATTTCCATGAATTCTACCACCCCCTAAATTATGCACATAATCTCATCTTTCTAACACTCTTTAGTGGGAA

AGGTAGGTCAAGACAATACCAATCCCCTGATATGTCCATCTATTGCGCTTTCAATTCACCACTACAAATT

CTACAAATTCGGGTTTAAGTTTTTGGCATGAACAATGTGGAGAAATTTTCTTCAGAAAACAGCATCTAGT

ATCTTTATGTTGCTGGAGTTGCATTATGTGGCTCTGATTAAACTAGAGTAACATCTGTAAGCTGTCTCCT

TTACATCTTTCAGAAGGGTAGTTAGAAGCAGATTTCTCTTGAATTAATAGAATTTGAGTCAATGGGATTG

CATCTGTGTCCCCTTAAATCCTATTATTTTCTGGGCTTGGATTCACCCTGGCACAAGCTCTTTCTGGCAC

CAGATTTTGTTCATTCTCTCTTAACTGGCACAGCTACTAGGTAGCTTTACACACCTAATGTAGCCTAGGA

GCTTGGATGATTATGCTTATGCTCTATCTGAATCCAAAAACAACCTAATGAAGCTTTTAATCTTGGAAAA

TAAGTCATATAGCATTATAAATCTCAAGTTCTATTGGTAAAAAGATAAAGTCCAAAATTTTACTTTGTAT

TTCTCAGTGAAAATTTTATCTTTAATACTACTAATAATAGCTAATGCTTGTATGGTATTTACCTTATGCC

AGACACGGTTCTGAGTGCTTTACATTTACTTACTAATTCTCACAAAGCCATATTAAGTATATACAGTTAT

TCATTTAAGTAGACATGAAACTGAATCACAAACAGAGTAGGTAATTTGCCAAAGATCATGAAAGCTAGGA

CATGGCAGAGCTGAGATTTCACTTCAGATATCTGGCCCCAGACTCTGTGCTATTAGTGTTATGCTGCCTC

TCACTTAGAAACCTTTCCTAAAACAAGAAAAGATTTTTAAAAGTGGGCTCCTTGGAAATAGATTTTGGTA

TTTTACATACTAAAATGACATAATCAAATATTTTAGAGTTTTACATTTTTAAATGAAACCATAAATGAAC

ATTTTTGTTTAGAATTGTCTTATCGATAAAGTGAGAATATTATTTTTATGTTTTCTTCCCACCCCCACCA

ACACACAAATATATATTAAAAATATAGGTAAAACTGTTTTAATAGAGGCTTCATTATCAAACTTGGGTTT

TCAAAAAAACAAATTAAAGTTACTCTTTACCTCAGATGAGCTGCTATTAGTCCCATCTGTGCAAATTTTC

ATATTACTTTGAATTTTATTAAAACAGAAATTGAACATAAAATATTGTACTTACCTTCTTGGGCATGTAA

AACTTAAATGTGAGCATCCTGGTGAGTTTGGGATTCTTGTAATTCTAAGAAAGTATAATGCATTGTTATT

AAGAAATGATCTCCAGCTAGATTACTAAATGTAATAATTTTAGTAAGAAAGGAAATATACTTACATTAAT

TCCATTCAAAATCATCTGTAAATCCAGCAGTAAATGCTCCAGTTGTAGCTGTGTTTTCTTTGTAGAACTT

GAAGTAGGTGCACTGTTTGTGACAAGTGCAAGACTTAGTGCAATGCAAGACAGGAGTTGCATCCTGTACA

TTGTGGCAGGAGTTGAGGTTACTGTGAGTAGTGATTAAAGAGAGTGATAGGGAACT

 

 

v. mRNA sequence: IL 2

 

>gi|125661059|ref|NM_000586.3| Homo sapiens interleukin 2 (IL2), mRNA

 

AGTTCCCTATCACTCTCTTTAATCACTACTCACAGTAACCTCAACTCCTGCCACAATGTACAGGATGCAA

CTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGTGCACCTACTTCAAGTTCTACAAAGA

AAACACAGCTACAACTGGAGCATTTACTGCTGGATTTACAGATGATTTTGAATGGAATTAATAATTACAA

GAATCCCAAACTCACCAGGATGCTCACATTTAAGTTTTACATGCCCAAGAAGGCCACAGAACTGAAACAT

CTTCAGTGTCTAGAAGAAGAACTCAAACCTCTGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTC

ACTTAAGACCCAGGGACTTAATCAGCAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAAACAAC

ATTCATGTGTGAATATGCTGATGAGACAGCAACCATTGTAGAATTTCTGAACAGATGGATTACCTTTTGT

CAAAGCATCATCTCAACACTGACTTGATAATTAAGTGCTTCCCACTTAAAACATATCAGGCCTTCTATTT

ATTTAAATATTTAAATTTTATATTTATTGTTGAATGTATGGTTTGCTACCTATTGTAACTATTATTCTTA

ATCTTAAAACTATAAATATGGATCTTTTATGATTCTTTTTGTAAGCCCTAGGGGCTCTAAAATGGTTTCA

CTTATTTATCCCAAAATATTTATTATTATGTTGAATGTTAAATATAGTATCTATGTAGATTGGTTAGTAA

AACTATTTAATAAATTTGATAAATATAAAAAAAAAAAAAAAAAAAAAAAAAA

 

vi. Hemoglobin alpha 1:

 

Gene seq:

 

>ref|NT_037887.4|Hs16_37891:166679-167520 Homo sapiens chromosome 16 genomic contig, reference assembly

 

ACTCTTCTGGTCCCCACAGACTCAGAGAGAACCCACCATGGTGCTGTCTCCTGCCGACAAGACCAACGTC

AAGGCCGCCTGGGGTAAGGTCGGCGCGCACGCTGGCGAGTATGGTGCGGAGGCCCTGGAGAGGTGAGGCT

CCCTCCCCTGCTCCGACCCGGGCTCCTCGCCCGCCCGGACCCACAGGCCACCCTCAACCGTCCTGGCCCC

GGACCCAAACCCCACCCCTCACTCTGCTTCTCCCCGCAGGATGTTCCTGTCCTTCCCCACCACCAAGACC

TACTTCCCGCACTTCGACCTGAGCCACGGCTCTGCCCAGGTTAAGGGCCACGGCAAGAAGGTGGCCGACG

CGCTGACCAACGCCGTGGCGCACGTGGACGACATGCCCAACGCGCTGTCCGCCCTGAGCGACCTGCACGC

GCACAAGCTTCGGGTGGACCCGGTCAACTTCAAGGTGAGCGGCGGGCCGGGAGCGATCTGGGTCGAGGGG

CGAGATGGCGCCTTCCTCGCAGGGCAGAGGATCACGCGGGTTGCGGGAGGTGTAGCGCAGGCGGCGGCTG

CGGGCCTGGGCCCTCGGCCCCACTGACCCTCTTCTCTGCACAGCTCCTAAGCCACTGCCTGCTGGTGACC

CTGGCCGCCCACCTCCCCGCCGAGTTCACCCCTGCGGTGCACGCCTCCCTGGACAAGTTCCTGGCTTCTG

TGAGCACCGTGCTGACCTCCAAATACCGTTAAGCTGGAGCCTCGGTGGCCATGCTTCTTGCCCCTTGGGC

CTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCG

GC

 

vii. mRNA: alpha 1

 

>gi|14456711|ref|NM_000558.3| Homo sapiens hemoglobin, alpha 1 (HBA1), mRNA

 

ACTCTTCTGGTCCCCACAGACTCAGAGAGAACCCACCATGGTGCTGTCTCCTGCCGACAAGACCAACGTC

AAGGCCGCCTGGGGTAAGGTCGGCGCGCACGCTGGCGAGTATGGTGCGGAGGCCCTGGAGAGGATGTTCC

TGTCCTTCCCCACCACCAAGACCTACTTCCCGCACTTCGACCTGAGCCACGGCTCTGCCCAGGTTAAGGG

CCACGGCAAGAAGGTGGCCGACGCGCTGACCAACGCCGTGGCGCACGTGGACGACATGCCCAACGCGCTG

TCCGCCCTGAGCGACCTGCACGCGCACAAGCTTCGGGTGGACCCGGTCAACTTCAAGCTCCTAAGCCACT

GCCTGCTGGTGACCCTGGCCGCCCACCTCCCCGCCGAGTTCACCCCTGCGGTGCACGCCTCCCTGGACAA

GTTCCTGGCTTCTGTGAGCACCGTGCTGACCTCCAAATACCGTTAAGCTGGAGCCTCGGTGGCCATGCTT

CTTGCCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAA

AGTCTGAGTGGGCGGC

 

 

viii. Hemoglobin Beta Chain

 

Gene:

 

>ref|NT_009237.17|Hs11_9394:4033937-4035542 Homo sapiens chromosome 11 genomic contig, reference assembly

 

GCAATGAAAATAAATGTTTTTTATTAGGCAGAATCCAGATGCTCAAGGCCCTTCATAATATCCCCCAGTT

TAGTAGTTGGACTTAGGGAACAAAGGAACCTTTAATAGAAATTGGACAGCAAGAAAGCGAGCTTAGTGAT

ACTTGTGGGCCAGGGCATTAGCCACACCAGCCACCACTTTCTGATAGGCAGCCTGCACTGGTGGGGTGAA

TTCTTTGCCAAAGTGATGGGCCAGCACACAGACCAGCACGTTGCCCAGGAGCTGTGGGAGGAAGATAAGA

GGTATGAACATGATTAGCAAAAGGGCCTAGCTTGGACTCAGAATAATCCAGCCTTATCCCAACCATAAAA

TAAAAGCAGAATGGTAGCTGGATTGTAGCTGCTATTAGCAATATGAAACCTCTTACATCAGTTACAATTT

ATATGCAGAAATATTTATATGCAGAGATATTGCTATTGCCTTAACCCAGAAATTATCACTGTTATTCTTT

AGAATGGTGCAAAGAGGCATGATACATTGTATCATTATTGCCCTGAAAGAAAGAGATTAGGGAAAGTATT

AGAAATAAGATAAACAAAAAAGTATATTAAAAGAAGAAAGCATTTTTTAAAATTACAAATGCAAAATTAC

CCTGATTTGGTCAATATGTGTACACATATTAAAACATTACACTTTAACCCATAAATATGTATAATGATTA

TGTATCAATTAAAAATAAAAGAAAATAAAGTAGGGAGATTATGAATATGCAAATAAGCACACATATATTC

CAAATAGTAATGTACTAGGCAGACTGTGTAAAGTTTTTTTTTAAGTTACTTAATGTATCTCAGAGATATT

TCCTTTTGTTATACACAATGTTAAGGCATTAAGTATAATAGTAAAAATTGCGGAGAAGAAAAAAAAAGAA

AGCAAGAATTAAACAAAAGAAAACAATTGTTATGAACAGCAAATAAAAGAAACTAAAACGATCCTGAGAC

TTCCACACTGATGCAATCATTCGTCTGTTTCCCATTCTAAACTGTACCCTGTTACTTATCCCCTTCCTAT

GACATGAACTTAACCATAGAAAAGAAGGGGAAAGAAAACATCAAGCGTCCCATAGACTCACCCTGAAGTT

CTCAGGATCCACGTGCAGCTTGTCACAGTGCAGCTCACTCAGTGTGGCAAAGGTGCCCTTGAGGTTGTCC

AGGTGAGCCAGGCCATCACTAAAGGCACCGAGCACTTTCTTGCCATGAGCCTTCACCTTAGGGTTGCCCA

TAACAGCATCAGGAGTGGACAGATCCCCAAAGGACTCAAAGAACCTCTGGGTCCAAGGGTAGACCACCAG

CAGCCTAAGGGTGGGAAAATAGACCAATAGGCAGAGAGAGTCAGTGCCTATCAGAAACCCAAGAGTCTTC

TCTGTCTCCACATGCCCAGTTTCTATTGGTCTCCTTAAACCTGTCTTGTAACCTTGATACCAACCTGCCC

AGGGCCTCACCACCAACTTCATCCACGTTCACCTTGCCCCACAGGGCAGTAACGGCAGACTTCTCCTCAG

GAGTCAGATGCACCATGGTGTCTGTTTGAGGTTGCTAGTGAACACAGTTGTGTCAGAAGCAAATGT

 

ix. mRNA hb b-chain

 

>gi|28302128|ref|NM_000518.4| Homo sapiens hemoglobin, beta (HBB), mRNA

 

ACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAGACACCATGGTGCATCTGACTCCTGA

GGAGAAGTCTGCCGTTACTGCCCTGTGGGGCAAGGTGAACGTGGATGAAGTTGGTGGTGAGGCCCTGGGC

AGGCTGCTGGTGGTCTACCCTTGGACCCAGAGGTTCTTTGAGTCCTTTGGGGATCTGTCCACTCCTGATG

CTGTTATGGGCAACCCTAAGGTGAAGGCTCATGGCAAGAAAGTGCTCGGTGCCTTTAGTGATGGCCTGGC

TCACCTGGACAACCTCAAGGGCACCTTTGCCACACTGAGTGAGCTGCACTGTGACAAGCTGCACGTGGAT

CCTGAGAACTTCAGGCTCCTGGGCAACGTGCTGGTCTGTGTGCTGGCCCATCACTTTGGCAAAGAATTCA

CCCCACCAGTGCAGGCTGCCTATCAGAAAGTGGTGGCTGGTGTGGCTAATGCCCTGGCCCACAAGTATCA

CTAAGCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACT

GGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATTTTCATTGC

 

Suggested reading:

1.    Randal L Schwartz, Tom Phoenix and Brian d foy, 2005, Learning perl, 4th edition, O’Reilly.

2.    Brian D Foy, 2006, Learning Perl Student Workbook, 4th edition, O’Reilly.

3.    Larry Wall, 2000, Programming Perl, 3rd Edition, O’Reilly

4.    James Tisdall, 2001, Beginning Bioperl for Bioinformatics, 1st edition, O’Reilly

5.    James D. Tisdall, 2003, Mastering Perl for Bioinformatics, 1st edition, O’Reilly

6.    Ian Korf, Mark Yandell, Joseph Bedell, 2003, BLAST, 1st edition, O’Reilly


rating: 3.70 from 114 votes | updated on: 30 Jan 2009 | views: 95077 |

Rate article:







excellent!bad…